Everything below concerns glucose-dependent. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Large randomised trials in adults with type 2 diabetes and in adults with obesity have reported reductions in body weight and improvements in several cardiovascular risk markers. One outcome trial found a lower incidence of major adverse cardiovascular events in participants with diabetes and established cardiovascular disease. Gastrointestinal effects such as nausea and vomiting are the most frequently reported adverse events and often diminish over time. Changes in lean body mass during weight loss are an area of ongoing investigation. Effects in adolescents and in pregnancy are less well characterised, and current labelling advises against use during pregnancy.
Semaglutide is a synthetic peptide analogue of glucagon-like peptide-1, a gut hormone released after nutrient intake. The molecule contains 31 amino acid residues and differs from the native sequence at several positions. A non-natural residue at position eight resists the enzyme that normally truncates the hormone, while a lysine-linked fatty diacid side chain promotes binding to serum albumin. These two modifications extend the circulating half-life from minutes to roughly one week. The peptide is produced by solid-phase synthesis followed by selective acylation, and its identity and purity are confirmed by spectrometric and chromatographic techniques.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 or 280 nanometres is widely used to assess purity and to resolve related impurities. Liquid chromatography coupled to mass spectrometry confirms identity through the protonated molecular ion and fragment ions formed in tandem experiments. Capillary electrophoresis and peptide mapping after enzymatic digestion supply complementary information on charge variants and modification sites. Circular dichroism and nuclear magnetic resonance can report on secondary structure in solution. Absolute quantification usually depends on an external standard, and reported purity depends on the detection wavelength and integration parameters chosen.
Lyophilised material appears as a white to off-white cake or powder that is hygroscopic, and containers are usually equilibrated to room temperature before opening to limit condensation. Dissolution is performed in water, phosphate-buffered saline, or a mildly alkaline buffer, since solubility rises above neutral pH. Gentle inversion or low-speed mixing is preferred, because vigorous vortexing can promote surface denaturation and aggregation. Complete dissolution may require several minutes, and brief sonication is sometimes applied. Passing the solution through a 0.22 micrometre membrane removes particulates but does not by itself sterilise the liquid.
Storage at minus 20 degrees Celsius or lower in a desiccated container preserves the peptide for extended periods, while working solutions are commonly held at two to eight degrees Celsius for short intervals. Light exposure and repeated freeze-thaw cycles accelerate degradation, so dividing material into single-use aliquots is generally recommended. Adsorption to glass and plastic surfaces can lower the measured concentration of dilute solutions, particularly below one milligram per millilitre. The degradation routes most often reported for GLP-1 analogues are deamidation, methionine oxidation, and backbone hydrolysis. Relative rates under specific conditions are frequently described only for individual formulations.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Acylated GLP-1 receptor agonist | 31-residue synthetic peptide |
| Molecular formula | C187H291N45O59 | established for the free peptide |
| Appearance | White to off-white powder | as supplied before formulation |
| Solubility | Freely soluble in water | aqueous buffers near neutral pH |
| Typical storage | 2 to 8 degrees Celsius, protected from light | powder and solution forms differ in shelf life |
Reverse-phase high-performance liquid chromatography is the standard method for purity assessment, separating the peptide from truncated or oxidized variants. Mass spectrometry confirms molecular mass and detects modifications, while ultraviolet absorbance near 280 nanometers supports concentration measurement through tryptophan and tyrosine residues. Circular dichroism can indicate secondary structure, though the peptide is largely helical in solution, and ion-exchange chromatography resolves charge variants. Purity values above 95 percent are typical for research-grade material. Stability studies track degradation over time under defined conditions.
Lyophilized semaglutide is typically stored at temperatures between minus 20 and minus 80 degrees Celsius for long-term preservation. Short-term storage at 2 to 8 degrees Celsius is common for working aliquots. Repeated freeze-thaw cycles can degrade the peptide and are usually avoided. The molecule is hygroscopic in its solid form, so containers should remain sealed with desiccant. Solutions are less stable than powders and are generally prepared fresh. Light exposure is limited because aromatic residues can undergo photo-oxidation.
Semaglutide dissolves readily in water and in aqueous buffers near neutral pH. Solubility decreases near the isoelectric point, where net charge is minimal. Common laboratory solvents include phosphate-buffered saline and dilute ammonium bicarbonate. Strongly acidic or basic conditions may accelerate hydrolysis. Working concentrations are usually prepared by diluting a concentrated stock. Vial surfaces can adsorb small amounts of peptide at low concentrations, so carrier proteins or low-binding tubes are sometimes used.
Clinical development of this compound followed earlier short-acting GLP-1 analogues that required frequent injection. Once-weekly subcutaneous formulations entered use after 2017, and an oral formulation using a permeation enhancer later became available. The oral version pairs the peptide with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, a carrier that improves uptake across the gastric epithelium. Interest has expanded from glycaemic control into weight management and metabolic liver disease. Regulatory status and approved indications differ between countries, and the product remains subject to ongoing safety monitoring.
Semaglutide is a synthetic peptide that acts as an agonist at the glucagon-like peptide-1 receptor. It is a structural analogue of human GLP-1(7-37), modified to resist enzymatic degradation by dipeptidyl peptidase-4. The peptide backbone contains alpha-aminoisobutyric acid at position 8, a substitution that stabilises the helix and slows cleavage. A fatty diacid side chain attached through a linker at lysine 34 promotes binding to serum albumin, which extends the circulating half-life. These two modifications together allow less frequent administration than native GLP-1 requires.
Activation of the GLP-1 receptor couples to Gs signalling and raises intracellular cyclic AMP in pancreatic beta cells. The resulting insulin release depends on prevailing glucose concentrations, so the effect is greater when glucose is elevated. Receptor engagement also suppresses glucagon secretion and slows gastric emptying, which flattens post-meal glucose excursions. In the central nervous system, signalling in hypothalamic and brainstem regions is associated with reduced appetite and lower energy intake. Studies continue to examine effects on cardiac, renal and hepatic endpoints; whether those benefits are independent of weight change remains an open question.
Receptor binding triggers G protein signaling that raises intracellular cyclic AMP in pancreatic beta cells. Insulin release follows in a glucose-dependent manner, so secretion increases when blood glucose is elevated and diminishes when it is not. The same signaling suppresses glucagon release from alpha cells and slows gastric emptying, which blunts the post-meal glucose rise. In the brain, receptor activation in regions such as the arcuate nucleus is associated with reduced appetite and lower energy intake. How much each of these effects contributes to overall weight change is not fully settled.
Two structural features account for the prolonged half-life of semaglutide. A modified amino acid at position 8 resists cleavage by dipeptidyl peptidase-4, the enzyme that rapidly degrades native GLP-1. A fatty diacid side chain binds serum albumin, which limits renal clearance and protects the peptide from enzymatic breakdown. These modifications yield a plasma half-life of approximately one week in humans, allowing once-weekly administration. The relationship between plasma concentration and clinical effect varies between individuals, and sources of that variability are still being characterized.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1 (GLP-1), a hormone released from intestinal L-cells after food intake. The compound belongs to the incretin mimetic class and acts at GLP-1 receptors distributed across pancreatic, gastrointestinal, cardiovascular, and central nervous system tissues. Compared with native GLP-1, the molecule carries structural changes that extend its activity from minutes to roughly one week. It is studied for glycemic control in type 2 diabetes and for weight management, and its effects on cardiovascular and other outcomes remain active research areas.
=== EC 1.14.99 Miscellaneous === EC 1.14.99.1: prostaglandin-endoperoxide synthase EC 1.14.99.2: kynurenine 7,8-hydroxylase EC 1.14.99.3: Now EC 1.14.14.18, heme oxygenase (biliverdin-producing) EC 1.14.99.4: progesterone monooxygenase EC 1.14.99.5: Now EC 1.14.19.1, stearoyl-CoA 9-desaturase EC 1.14.99.6: Now EC 1.14.19.2, acyl-[acyl-carrier-protein] desaturase EC 1.14.99.7: Transferred to EC 1.14.13.132, squalene monooxygenase EC 1.14.99.8: Now included with EC 1.14.14.1 unspecific monooxygenase EC 1.14.99.9: Now classified as EC 1.14.14.19, steroid 17α-monooxygenase EC 1.14.99.10: Now EC 1.14.14.16, steroid 21-monooxygenase EC 1.14.99.11: estradiol 6β-monooxygenase EC 1.14.99.12: 4-androstene-3,17-dione monooxygenase EC 1.14.99.13: Now EC 1.14.13.23, 3-hydroxybenzoate 4-monooxygenase EC 1.14.99.14: Now EC 1.14.14.197, progesterone 11α-monooxygenase EC 1.14.99.15: 4-methoxybenzoate monooxygenase (O-demethylating) EC 1.14.99.16: Now EC 1.14.13.72, methylsterol monooxygenase EC 1.14.99.17: Now EC 1.14.16.5, glyceryl-ether monooxygenase EC 1.14.99.18: deleted EC 1.14.99.19: Now classified as EC 1.14.19.77, plasmanylethanolamine desaturase EC 1.14.99.20: phylloquinone monooxygenase (2,3-epoxidizing) EC 1.14.99.21: Latia-luciferin monooxygenase (demethylating) EC 1.14.99.22: ecdysone 20-monooxygenase EC 1.14.99.23: 3-hydroxybenzoate 2-monooxygenase EC 1.14.99.24: steroid 9α-monooxygenase EC 1.14.99.25: Now EC 1.14.19.3, linoleoyl-CoA desaturase EC 1.14.99.26: 2-hydroxypyridine 5-monooxygenase EC 1.14.99.27: Now classified as EC 1.17.3.4, juglone 3-monooxygenase EC 1.14.99.28: Now EC 1.14.14.84, linalool 8-monooxygenase EC 1.14.99.29: deoxyhypusine monooxygenase EC 1.14.99.30: Now EC 1.3.5.6, 9,9′-dicis-ζ-carotene desaturase. EC 1.14.99.31: Now classified as EC 1.14.19.24, myristoyl-CoA 11-(E) desaturase EC 1.14.99.32: Now classified as EC 1.14.19.5, acyl-CoA 11-(Z)-desaturase EC 1.14.99.33: Now EC 1.14.19.39, acyl-lipid Δ12-acetylenase EC 1.14.99.34: monoprenyl isoflavone epoxidase EC 1.14.99.35: thiophene-2-carbonyl-CoA monooxygenase EC 1.14.99.36: Now classified as EC 1.13.11.63, β-carotene 15,15′-dioxygenase EC 1.14.99.37: Now EC 1.14.14.176, taxadiene 5α-hydroxylase EC 1.14.99.38: cholesterol 25-hydroxylase EC 1.14.99.39: ammonia monooxygenase EC 1.14.99.40: Now EC 1.13.11.79, 5,6-dimethylbenzimidazole synthase EC 1.14.99.41: Now EC 1.13.11.75, all-trans-8′-apo-β-carotenal 15,15′-oxygenase EC 1.14.99.42: Now EC 1.13.11.84, crocetin dialdehyde synthase EC 1.14.99.43: Now EC 1.14.14.134, β-amyrin 24-hydroxylase EC 1.14.99.44: diapolycopene oxygenase EC 1.14.99.45: Now EC 1.14.14.158, carotene ε-monooxygenase EC 1.14.99.46: pyrimidine oxygenase EC 1.14.99.47: (+)-larreatricin hydroxylase EC 1.14.99.48: heme oxygenase (staphylobilin-producing) EC 1.14.99.49: Now EC 1.14.15.31, 2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase EC 1.14.99.50: γ-glutamyl hercynylcysteine S-oxide synthase EC 1.14.99.51: hercynylcysteine S-oxide synthase EC 1.14.99.52: L-cysteinyl-L-histidinylsulfoxide synthase EC 1.14.99.53: lytic chitin monooxygenase EC 1.14.99.54: lytic cellulose monooxygenase (C1-hydroxylating) EC 1.14.99.55: lytic starch monooxygenase EC 1.14.99.56: lytic cellulose monooxygenase (C4-dehydrogenating) EC 1.14.99.57: heme oxygenase (mycobilin-producing) EC 1.14.99.58: heme oxygenase (biliverdin-IX-β and δ-forming) EC 1.14.99.59: tryptamine 4-monooxygenase EC 1.14.99.60: 3-demethoxyubiquinol 3-hydroxylase EC 1.14.99.61: cyclooctat-9-en-7-ol 5-monooxygenase EC 1.14.99.62: cyclooctatin synthase EC 1.14.99.63: β-carotene 4-ketolase EC 1.14.99.64: zeaxanthin 4-ketolase EC 1.14.99.65: 4-amino-L-phenylalanyl-[CmlP-peptidyl-carrier-protein] 3-hydroxylase EC 1.14.99.66: [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase EC 1.14.99.67: α-N-dichloroacetyl-p-aminophenylserinol N-oxygenase EC 1.14.99.68: 4-aminobenzoate N-oxygenase EC 1.14.99.69: tRNA 2-(methylsulfanyl)-N6-isopentenyladenosine37 hydroxylase
Whitesides, "Self-assembly is the autonomous organization of components into patterns or structures without human intervention." Another definition by Serge Palacin & Renaud Demadrill is "Self-assembly is a spontaneous and reversible process that brings together in a defined geometry randomly moving distinct bodies through selective bonding forces." Importance To commemorate the 125th anniversary of Science magazine, 25 urgent questions were asked for scientists to solve, and the only one that relates to chemistry is"How Far Can We Push Chemical Self-Assembly?" Because self-assembly is the only approach for building a wide variety of nanostructures, the need for increasing complexity is growing. To learn from nature and build the nanoworld with noncovalent bonds, more research is needed in this area. Self assembly of nanomaterials is currently considered broadly for nano-structuring and nano-fabrication because of its simplicity, versatility and spontaneity. Exploiting the properties of the nano assembly holds promise as a low-cost and high-yield technique for a wide range of scientific and technological applications and is a key research effort in nanotechnology, molecular robotics, and molecular computation. A summary of benefits of self-assembly in fabrication is listed below:
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
intein Any sequence of one or more amino acids within a precursor polypeptide that is excised by protein splicing during post-translational modification and is therefore absent from the mature protein, analogous to the introns spliced out of RNA transcripts. Contrast extein.
Knowing Nixon's fears, Kissinger told him that if he did nothing, "it shows that you're weak, Mr. President. The fact that some idiot can publish all the diplomatic secrets of this country on his own is damaging to your image as far as the Soviets are concerned and it could destroy our ability to conduct foreign policy". Daniel Ellsberg, the man who leaked the Pentagon Papers to the New York Times, had been consulted by Kissinger for ideas about Vietnam in late 1968–early 1969, but when he leaked the papers, Kissinger told Nixon that he was a left-wing "fanatic" and a "drug abuser". Kissinger depicted Ellsberg to Nixon as a drug-crazed, sexually perverted degenerate of questionable mental stability out to ruin his administration. Reflecting his increasing frustration with the war, Nixon often talked to Kissinger in a bloodthirsty manner about a "fantasy holocaust" in which he would have U.S. forces kill every living thing in North Vietnam and then pull out, leading the latter appalled by his own account. By early 1972, Nixon boasted that he had pulled out 400,000 U.S. soldiers from Vietnam since July 1969, and battle deaths had fallen from an average of 200 per week in 1969 down to an average of 10 per week in 1972. The policy of Vietnamization had, as Laird predicted, tamed the antiwar movement as most Americans objected not to the war in Vietnam per se, only to Americans dying in it.
Sources: en.wikipedia.org
In Canada, six years after regulating of denturists commenced, the fees quoted in their fee guide were similar to those of dentists. Consequently, most of these campaigns have so far failed. In some jurisdictions, denturists must operate under the supervision or oral health certificate of a dentist. Many dentists argue that this does not happen. For example, in 1991, investigators hired by the Arizona Dental Association found that only three out of the state's 13 denturists advised callers to see a dentist before visiting them. Many denturists argue that from a business point of view dentists are viewed as competition and in many locations dentists may "steal their business" after doing an exam. With the work of the IFD and other denturist campaigns across the globe, there is hope for clearer recognition and scope in future.
Salvia divinorum was first recorded in print by Jean Basset Johnson in 1939 while he was studying Mazatec shamanism. He later documented its use and reported its effects through personal testimonials of users. It was not until 2002 that Bryan Roth and his team identified the psychoactive mechanism. Gordon Wasson tentatively postulated that the plant could be the mythological pipiltzintzintli, the "Noble Prince" of the Aztec codices. Wasson's speculation has been the subject of further debate amongst ethnobotanists, with some scepticism coming from Leander J. Valdés, and counterpoints more supportive of Wasson's theory from Jonathan Ott. The identity of another mysterious Aztec entheogen, namely that of poyomatli, has also been suggested as being Salvia divinorum. Here too there are other candidate plants, notably cacahuaxochitl (Quararibea funebris),
At clinically studied doses in humans (up to 600 mg/day), which are much lower on a mg/kg basis than those used in the preceding animal studies, bicalutamide has only shown increases in testosterone levels and no testosterone suppression. There is some indication that the related NSAA nilutamide may also have SARM-like properties in certain tissues, as suggested by stimulation of erythropoiesis in men with prostate cancer. Additionally, hydroxyflutamide, the active metabolite of the related NSAA flutamide, has shown SARM-like activity in an androgen-responsive osteoblast cell line. Similarly, along with CPA, flutamide and hydroxyflutamide, though not bicalutamide, have been reported to act as SARMs or AR partial agonists in prostate cancer cells. Novel SARMs like enobosarm, with antiandrogenic effects in the prostate gland like bicalutamide but potent anabolic effects in muscle and bone, have also been developed. Bicalutamide has also been described as a functional "SARM" due to peripheral selectivity and inability to cross into the central nervous system and block ARs in this part of the body, resulting in antiandrogenic action in the periphery and lack of effects in the brain. However, while peripheral selectivity was initially observed in animal studies, bicalutamide did not end up showing peripheral selectivity in humans.
== Regulatory scrutiny == The Royal Australian College of General Practitioners (RACGP) raised concerns in 2023 about telehealth services using remote questionnaires to prescribe GLP-1 receptor agonists, questioning whether such methods provided adequate clinical assessment. The Therapeutic Goods Administration (TGA) warned telehealth companies against advertising prescription-only medicines directly to consumers. During GLP-1 medication shortages in 2023–2024, Eucalyptus partnered with compounding pharmacies to provide compounded semaglutide. This practice drew criticism from pharmaceutical manufacturers and regulators. The Australian federal government subsequently banned pharmacy compounding of GLP-1 drugs from October 2024. Media reports in The Sydney Morning Herald and The Australian questioned whether social media and influencer campaigns for Eucalyptus brands overstated treatment results. ABC's Media Watch raised concerns about whether television segments promoting the company's services blurred editorial and advertising boundaries. In response to regulatory concerns, Eucalyptus introduced phone-based GP consultations to replace asynchronous online forms. In June 2025, the TGA issued class-wide safety warnings for all GLP-1 and dual GIP/GLP-1 receptor agonists, including medications prescribed through Juniper, regarding aspiration risks during general anaesthesia. The warnings required updates to product information across all suppliers of these medications.
=== Organization of complexes === The original model for how the respiratory chain complexes are organized was that they diffuse freely and independently in the mitochondrial membrane. However, recent data suggest that the complexes might form higher-order structures called supercomplexes or "respirasomes". In this model, the various complexes exist as organized sets of interacting enzymes. These associations might allow channeling of substrates between the various enzyme complexes, increasing the rate and efficiency of electron transfer. Within such mammalian supercomplexes, some components would be present in higher amounts than others, with some data suggesting a ratio between complexes I/II/III/IV and the ATP synthase of approximately 1:1:3:7:4. However, the debate over this supercomplex hypothesis is not completely resolved, as some data do not appear to fit with this model.
Sources: en.wikipedia.org
Native GLP-1 is degraded within minutes by dipeptidyl peptidase-4 and neutral endopeptidases. Semaglutide carries a non-natural amino acid at position eight that blocks that cleavage, and a fatty diacid side chain that binds albumin. The result is a much longer duration of action than the native hormone.
The fatty diacid chain associates strongly with serum albumin, which keeps the peptide in circulation and shields it from rapid renal clearance. Bound peptide is released gradually, producing a sustained receptor signal. This mechanism also reduces the peak-to-trough variation seen with shorter-acting analogues.
The balance between peripheral receptor activation and signalling in the central nervous system is not fully resolved. The extent to which slowed gastric emptying accounts for reduced energy intake, compared with direct effects on appetite circuits, is debated. Long-term effects on lean mass and on tissues outside the gut and brain are still under study.
Filtering removes particulate matter that can block columns or scatter light. A 0.22 micrometre membrane is typical, and the filter material should be checked for peptide adsorption.